PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G082200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YB
Protein Properties Length: 283aa    MW: 31390.5 Da    PI: 9.5529
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G082200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB176.32.9e-5586180397
               NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                         eqdrflPianvsrimkk lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv +lkvyl+kyr++
  Potri.007G082200.1  86 EQDRFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMSTLGFENYVGSLKVYLNKYRDT 176
                         8****************************************************************************************** PP

               NF-YB  94 egek 97 
                         egek
  Potri.007G082200.1 177 EGEK 180
                         *997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.5E-5281196IPR009072Histone-fold
SuperFamilySSF471132.48E-4087198IPR009072Histone-fold
PfamPF008083.0E-2790154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-19118136No hitNo description
PROSITE patternPS006850121137IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.4E-19137155No hitNo description
PRINTSPR006151.4E-19156174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
RLSTFLYFWP LYPTSPSIKA QTPLVRFYNQ SFKQKKNTCS LSSPALASSS LLLYIWLPKM  60
TGKRTQISPI GSPLSENISE SSSKLEQDRF LPIANVSRIM KKSLPANAKI SKEAKETVQE  120
CVSEFISFIT GEASDKCQRE KRKTINGDDL LWAMSTLGFE NYVGSLKVYL NKYRDTEGEK  180
NSMARQEDQL SPTNHGSLGT HETIKVNGSP SLSTGMDLQS FNAGLYSLGT EVTAKSYGQN  240
TRFLGYQESS MVGDFNMNKI RDHGDRNGNI AMAGQLHHGV GW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B6e-4486175392Transcription factor HapC (Eurofung)
4g92_B6e-4486175392Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.135110.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ1618800.0HQ161880.1 Populus euphratica nuclear transcription factor Y-alpha (NFYA) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025616.11e-156PREDICTED: nuclear transcription factor Y subunit B-1-like
TrEMBLF8RS741e-165F8RS74_POPEU; Nuclear transcription factor Y-alpha (Fragment)
STRINGPOPTR_0007s06480.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.18e-60nuclear factor Y, subunit B3